Introduction | West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins. |
Description | The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. |
Method | Purified by proprietary chromatographic technique. |
Purity | Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Formulation | 20mM phosphate buffer pH 7.5. |
Storage | Protein is shipped at ambient temperature. Upon arrival, Store at -20°C. |
Stability | Five years frozen. One month in solution at room temperature. |
Specificity | Immunoreactive with sera of West Nile virus infected individuals. |
Applications | Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. |
Amino Acid Sequence | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK ATRYLVKTESWILRNPGYALE. |
Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals. |