pCMV-Tag 4B PVT1029 2ug
Search name
pCMV-Tag 4B,Plasmid pCMV-Tag 4B,pCMV-Tag 4B vector
pCMV-Tag 4B Information
Promoter: CMV
Replicon: pUC ori, F1 ori
Terminator: SV40 poly (A) signal
Plasmid Classification: Mammalian Cell Vector; Protein Overexpression Plasmid
Plasmid size: 4320 BP
Plasmid tag: C-FLAG tag
Prokaryotic resistance: kanamycin Kan
Screening marker: neomycin Neo
Cloning strain: XL1-Blue
Culture conditions: 37 C, aerobic, LB
Expression host: mammalian cells
Culture conditions: 37 C, aerobic, LB
Induction mode: instantaneous expression without induction
5'Sequencing Primers: CMV-F: CGCAAATGGGGGGGTAGGGGGGGTG
3'Sequencing Primers: Sequence-based Design
pCMV-Tag 4B Sites
![](http://item.yiqi.com/pic/ConPic/4/pCMV-Tag%204B-vector.png)
pCMV-Tag 4B Sequence
LOCUS Exported 4320 bp ds-DNA circular SYN 28-Nov-2013
DEFINITION Mammalian expression vector for tagging proteins with a C-terminal
FLAG epitope. For other reading frames, use pCMV-Tag 4A or pCMV-Tag
4C.
ACCESSION .
VERSION .
KEYWORDS pCMV-Tag 4B
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4320)
AUTHORS Agilent Technologies
TITLE Direct Submission
JOURNAL Exported 2016-09-18 from SnapGene Viewer 2.8.1
COMMENT The cloned gene must include a Kozak sequence and start codon.
FEATURES Location/Qualifiers
source 1..4320
/organism="synthetic DNA construct"
/lab_host="Mammalian Cells"
/mol_type="other DNA"
enhancer 66..370
/note="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 371..574
/note="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 620..638
/note="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
misc_feature 651..744
/note="MCS"
/note="multiple cloning site"
CDS 745..768
/codon_start=1
/product="FLAG epitope tag, followed by an enterokinase
cleavage site"
/note="FLAG"
/translation="DYKDDDDK"
misc_feature 784..794
/note="stop codons"
/note="stop codons in all three reading frames"
promoter complement(822..840)
/note="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
polyA_signal 1114..1235
/note="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
rep_origin complement(1242..1697)
/direction=LEFT
/note="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 1724..1826
/gene="bla"
/note="AmpR promoter"
promoter 1830..2187
/note="SV40 promoter"
/note="SV40 enhancer and early promoter"
CDS 2222..3016
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/note="NeoR/KanR"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin)"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
misc_feature 3248..3295
/note="HSV TK poly(A) signal"
/note="herpesvirus thymidine kinase polyadenylation signal"
rep_origin 3624..4212
/direction=RIGHT
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
ORIGIN
1 atgcattagt tattaatagt aatcaattac ggggtcatta gttcatagcc catatatgga
61 gttccgcgtt acataactta cggtaaatgg cccgcctggc tgaccgccca acgacccccg
121 cccattgacg tcaataatga cgtatgttcc catagtaacg ccaataggga ctttccattg
181 acgtcaatgg gtggagtatt tacggtaaac tgcccacttg gcagtacatc aagtgtatca
241 tatgccaagt acgcccccta ttgacgtcaa tgacggtaaa tggcccgcct ggcattatgc
301 ccagtacatg accttatggg actttcctac ttggcagtac atctacgtat tagtcatcgc
361 tattaccatg gtgatgcggt tttggcagta catcaatggg cgtggatagc ggtttgactc
421 acggggattt ccaagtctcc accccattga cgtcaatggg agtttgtttt ggcaccaaaa
481 tcaacgggac tttccaaaat gtcgtaacaa ctccgcccca ttgacgcaaa tgggcggtag
541 gcgtgtacgg tgggaggtct atataagcag agctggttta gtgaaccgtc agatccgcta
601 gcgattacgc caagctcgaa attaaccctc actaaaggga acaaaagctg gagctccacc
661 gcggtggcgg ccgctctagc ccgggcggat cccccgggct gcaggaattc gatatcaagc
721 ttatcgatac cgtcgacact cgaggattac aaggatgacg acgataagta gggcccggta
781 ccttaattaa ttaaggtacc aggtaagtgt acccaattcg ccctatagtg agtcgtatta
841 caattcactc gatcgccctt cccaacagtt gcgcagcctg aatggcgaat ggagatccaa
901 tttttaagtg tataatgtgt taaactactg attctaattg tttgtgtatt ttagattcac
961 agtcccaagg ctcatttcag gcccctcagt cctcacagtc tgttcatgat cataatcagc
1021 cataccacat ttgtagaggt tttacttgct ttaaaaaacc tcccacacct ccccctgaac
1081 ctgaaacata aaatgaatgc aattgttgtt gttaacttgt ttattgcagc ttataatggt
1141 tacaaataaa gcaatagcat cacaaatttc acaaataaag catttttttc actgcattct
1201 agttgtggtt tgtccaaact catcaatgta tcttaacgcg taaattgtaa gcgttaatat
1261 tttgttaaaa ttcgcgttaa atttttgtta aatcagctca ttttttaacc aataggccga
1321 aatcggcaaa atcccttata aatcaaaaga atagaccgag atagggttga gtgttgttcc
1381 agtttggaac aagagtccac tattaaagaa cgtggactcc aacgtcaaag ggcgaaaaac
1441 cgtctatcag ggcgatggcc cactacgtga accatcaccc taatcaagtt ttttggggtc
1501 gaggtgccgt aaagcactaa atcggaaccc taaagggagc ccccgattta gagcttgacg
1561 gggaaagccg gcgaacgtgg cgagaaagga agggaagaaa gcgaaaggag cgggcgctag
1621 ggcgctggca agtgtagcgg tcacgctgcg cgtaaccacc acacccgccg cgcttaatgc
1681 gccgct <
温馨提示:不可用于临床ZL。