Recombinant Human Tissue Factor Pathway Inhibitor 2

Synonyms TFPI-2, REF1,Placental protein 52. 

Introduction  TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesn’t have any influence on thrombin. 

Recombinant Human Tissue Factor Pathway Inhibitor 2Description  TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. 

Source Nicotiana benthamiana 

Physical Appearence  Sterile Filtered White lyophilized (freeze-dried) powder. 

Formulation  Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1. 

Solubility  It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions. 

Stability  Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. 

Recombinant Human Tissue Factor Pathway Inhibitor 2Purity  Greater than 97.0% as determined by SDS-PAGE. 

Amino Acid Sequence HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. 

Biological Activity  The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein.