Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

Synonyms       Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF. 

Introduction       The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration. 

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-TerminusDescription        MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa. 

Source      Escherichia Coli. 

Physical Appearance      Sterile Filtered lyophilized powder. 

Formulation       Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. 

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-TerminusSolubility It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. 

Stability       Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below

-18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Please prevent freeze-thaw cycles. 

Purity      Greater than 95.0% as determined by(a) Analysis by RP-HPLC.

(b) Analysis by SDS-PAGE. 

Biological Activity      Measured by its ability to bind rhCD74 in a functional ELISA. 

Amino Acid Sequence       MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGS

SEPALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVG

WNNSTFALEHHHHHH. 

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-TerminusUsage       CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.