Recombinant Human Long R3 Insulin Like Growth Factor-1

Synonyms       R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1. 

Introduction     IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues. 

Recombinant Human Long R3 Insulin Like Growth Factor-1Description      The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.

Recombinant Human Long R3 Insulin Like Growth Factor-1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa. 

Source     Escherichia Coli. 

Recombinant Human Long R3 Insulin Like Growth Factor-1Physical Appearance      Sterile Filtered White lyophilized (freeze-dried) powder. 

Formulation     Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.  

Solubility       It is recommended to reconstitute the lyophilized Long R3 IGF1 in sterile 18M?-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. 

Stability       Lyophilized Long R3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the Long R3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Please prevent freeze-thaw cycles. 

Purity     Greater than 95.0% as determined by SDS-PAGE. 

Aminoacidsequence       MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA. 

Recombinant Human Long R3 Insulin Like Growth Factor-1Biological Activity       The as determined by the stimulation of protein synthesis in L6 myoblasts is less then 10 ng/ml, corresponding to a specific activity of 100,000 units/mg. 

Usage       CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.