Recombinant Human BAFF (BLyS) Receptor

Synonyms       TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.

Introduction     B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.

Recombinant Human BAFF (BLyS) ReceptorDescription     B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.

The BAFF-R is purified by proprietary chromatographic techniques.

Source     Escherichia Coli.

Physical Appearance      Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation    Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.

Recombinant Human BAFF (BLyS) ReceptorSolubility          It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability   Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.

Please prevent freeze-thaw cycles.

Amino Acid Sequence    MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG

ASSPAPRTALQPQESVGAGAGEAALPLPG.

Purity       Greater than 95.0% as determined by(a) Analysis by RP-HPLC.

(b) Analysis by SDS-PAGE.

Recombinant Human BAFF (BLyS) ReceptorBiological Activity   Determined by its ability to block BAFF induced mouse splenocyte survival. The expected for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0?g/ml of human soluble BAFF.

Usage       CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.