Catalogue Number | DEN-006 |
Introduction | Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus. |
Description | The E.coli derived recombinant 15kDa protein is genetically engineered peptide which is derived from Dengue Type-2 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400, and is fused with a 6 His Tag. This peptide is particularly important for diagnostic and vaccine development as it contains multiple serotypes, neutralizing epitopes and receptor binding domain. |
Method | Purified by proprietary chromatographic technique. |
Purity | Protein is >95% pure as determined by 12% PAGE (coomassie staining). |
Formulation | 1xPBS pH 7.4. |
Stability | Dengue Envelope-ST2 D-III although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles. |
Applications | Each laboratory should determine an optimum working titer for use in its particular application. |
Sequence | SYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVL
GRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLDWFKKGSSIG
QMFETTMRGAKRMA. |
Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |