Introduction | Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus. |
Description | :
The E.coli derived recombinant 11 kDa protein is genetically engineered peptide which is derived from Dengue Type-1 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400. This peptide is particular important for diagnostic and vaccine development as it contains multiple serotype, neutralizing epitopes and receptor binding domain. |
Method | Purified by proprietary chromatographic technique. |
Purity | Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Formulation | 50mM sodium chloride-phosphorous buffer, pH-7.4. |
Storage | Protein is shipped at ambient temperature.
Upon arrival, Store at -20°C. |
Stability | Five years frozen. One month in solution at room temperature. |
Applications | Each laboratory should determine an optimum working titer for use in its particular application. |
Sequence | VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQN
GRLITANPIVTDKEKPVNIEAEPP FGESYIVVGAGEKALKLSWFKKGSV. |
Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |